Structure of PDB 7jy6 Chain I

Receptor sequence
>7jy6I (length=300) Species: 562 (Escherichia coli) [Search protein sequence]
SMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAA
QREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALA
RSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLK
QSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKE
GENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKL
IEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNS
3D structure
PDB7jy6 Mechanism of strand exchange from RecA-DNA synaptic and D-loop structures.
ChainI
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna I M164 R196 M197 K198 I199 N213 M131 R163 M164 K165 I166 N180
BS02 dna I G204 N205 R226 R227 G229 G171 N172 R193 R194 G196
BS03 AGS I S69 G71 K72 T73 T74 Y103 Y264 S36 G38 K39 T40 T41 Y70 Y231
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0140297 DNA-binding transcription factor binding
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0000725 recombinational repair
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0006974 DNA damage response
GO:0009432 SOS response
GO:0010212 response to ionizing radiation
GO:0019985 translesion synthesis
GO:0035825 homologous recombination
GO:0048870 cell motility
Cellular Component
GO:0005737 cytoplasm
GO:0009355 DNA polymerase V complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7jy6, PDBe:7jy6, PDBj:7jy6
PDBsum7jy6
PubMed33057191
UniProtP0A7G6|RECA_ECOLI Protein RecA (Gene Name=recA)

[Back to BioLiP]