Structure of PDB 7g00 Chain I

Receptor sequence

>7g00I (length=127) Species: 9606 (Homo sapiens) [Search protein sequence]

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF
TITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKS
VTELNGDIITNTMTLGDIVFKRISKRI

3D structure

PDB

7g00 Crystal Structure of a human FABP1 complex

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	WII	I	S39 F50 I52 N61 M74 M113 R122 S124	S39 F50 I52 N61 M74 M113 R122 S124

Gene Ontology

	Molecular Function
GO:0003682	chromatin binding
GO:0005324	long-chain fatty acid transmembrane transporter activity
GO:0005504	fatty acid binding
GO:0005515	protein binding
GO:0005543	phospholipid binding
GO:0008289	lipid binding
GO:0016209	antioxidant activity
GO:0032052	bile acid binding
GO:0070538	oleic acid binding
GO:1901363	heterocyclic compound binding

	Biological Process
GO:0015908	fatty acid transport
GO:0015909	long-chain fatty acid transport
GO:0032000	positive regulation of fatty acid beta-oxidation
GO:0033552	response to vitamin B3
GO:0043066	negative regulation of apoptotic process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0050892	intestinal absorption
GO:0070301	cellular response to hydrogen peroxide
GO:0071456	cellular response to hypoxia
GO:0098869	cellular oxidant detoxification

External links

PDB	RCSB:7g00, PDBe:7g00, PDBj:7g00
PDBsum	7g00
PubMed
UniProt	P07148\|FABPL_HUMAN Fatty acid-binding protein, liver (Gene Name=FABP1)