Structure of PDB 7eu0 Chain I

Receptor sequence
>7eu0I (length=113) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
STMKFCRECNNILYPKEDKEQKILLYACRNCDHQEVADNSCVYRNEVHHS
VSERTQILTDVASDPTLPRTKAVRCSKCQHREAVFFQATARGEEGMTLFF
VCCNPNCGHRWRE
3D structure
PDB7eu0 Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
ChainI
Resolution3.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN I C76 C103 C108 C75 C102 C107
BS02 ZN I C7 C10 C29 C6 C9 C28
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
Cellular Component
GO:0000419 RNA polymerase V complex
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005665 RNA polymerase II, core complex
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7eu0, PDBe:7eu0, PDBj:7eu0
PDBsum7eu0
PubMed34941388
UniProtQ6NLH0|RPB9A_ARATH DNA-directed RNA polymerases II, IV and V subunit 9A (Gene Name=NRPB9A)

[Back to BioLiP]