Structure of PDB 7duk Chain I

Receptor sequence

>7dukI (length=127) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLR
AVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGF
LTRDARVVERKKYGKHKARRAPQYSKR

3D structure

PDB

7duk Crystal structure of the Thermus thermophilus (HB8) 30S ribosomal subunit with mRNA and cognate transfer RNA anticodon stem-loop and sisomicin derivative N1,3''MS bound

Chain

Resolution

3.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	Y5 T7 R9 R10 K11 E12 V14 R16 R20 Y36 G39 R66 G68 G69 K70 S71 Q73 R83 R93 K97 T103 R104 R107 V108 V109 E110 R111 K112 K113 Y114 G115 K118 R120 R121 A122 Q124 Y125 S126	Y4 T6 R8 R9 K10 E11 V13 R15 R19 Y35 G38 R65 G67 G68 K69 S70 Q72 R82 R92 K96 T102 R103 R106 V107 V108 E109 R110 K111 K112 Y113 G114 K117 R119 R120 A121 Q123 Y124 S125

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7duk, PDBe:7duk, PDBj:7duk
PDBsum	7duk
PubMed
UniProt	P80374\|RS9_THET8 Small ribosomal subunit protein uS9 (Gene Name=rpsI)

[Back to BioLiP]