Structure of PDB 7dqo Chain I

Receptor sequence

>7dqoI (length=169) Species: 27405 (Penaeus japonicus)

ASQVRQNYHEDCEASINKQINMELYASYVYLSMAYYFERDDVALPGFAKF
FKESSDEEREHAQTFMKYQNKRGGRIVLQQIAAPSMQEWGTGLEALQAAL
DLEKQVNQSLLELHSTASGNNDPHLTKLLEREYLEEQVDSIKKIGDMITK
LKRAGPTGLGEYMFDKELN

3D structure

• PDB: 7dqo Hyperthermostability of prawn ferritin nanocage facilitates its application as a robust nanovehicle for nutraceuticals.
• Chain: I
• Resolution: 1.701 Å

Enzymatic activity

• Enzyme Commision number: 1.16.3.1: ferroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE	I	E24 E59 H62	E23 E58 H61

Gene Ontology

Molecular Function

• GO:0004322 ferroxidase activity
• GO:0008198 ferrous iron binding
• GO:0008199 ferric iron binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006826 iron ion transport
• GO:0006879 intracellular iron ion homeostasis
• GO:0006880 intracellular sequestering of iron ion

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:7dqo, PDBe:7dqo, PDBj:7dqo
• PDBsum: 7dqo
• UniProt: T2B7E1