Structure of PDB 7dh0 Chain I |
>7dh0I (length=71) Species: 9913 (Bos taurus) [Search protein sequence] |
YRKVRFVGRQKEVNENFAIDLIAEQPVSQVGSRVISCDGGGGALGHPRVY INLDKETKTGTCGYCGLQFRQ |
|
PDB | 7dh0 A Dynamic Substrate Pool Revealed by cryo-EM of a Lipid-Preserved Respiratory Supercomplex. |
Chain | I |
Resolution | 4.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
I |
C87 H96 C115 |
C37 H46 C65 |
|
|
|
|