Structure of PDB 7d8o Chain I

Receptor sequence

>7d8oI (length=163) Species: 562 (Escherichia coli)

MAKFFTISSSYIKYLKDFDDKVPNSEDPTYNNPKAFIGIVLEIEGHKYLA
PLTSPKAWHANVKESSPAFFKLHENGVPDNQLGLINLKFMIPIIEAEVSL
LDLDSMPDTPYKRMLYKQLQFIRVNEDKISEKSKLLRNLALQGRMQGTCD
FAVLEEKYQHFGK

3D structure

• PDB: 7d8o Identification, functional characterization, assembly and structure of ToxIN type III toxin-antitoxin complex from E. coli.
• Chain: I
• Resolution: 2.097 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	K2 F3 Y29 N30 N31 K33 L51 T52 S53 P54 K55 E73 N79 L81 L100 L102 D103 P109 Y110 M113 Y115 K116 Q117 R122 V123	K3 F4 Y30 N31 N32 K34 L52 T53 S54 P55 K56 E74 N80 L82 L101 L103 D104 P110 Y111 M114 Y116 K117 Q118 R123 V124
BS02	rna	I	D19 K20 V21 P22 N23 W57 N60 K62 E63 S64 S65 P66 K87 F88 L134 L138 R143 M144	D20 K21 V22 P23 N24 W58 N61 K63 E64 S65 S66 P67 K88 F89 L135 L139 R144 M145

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 16:03:00 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7d8o', asym_id = 'I', title = 'Identification, functional characterization, ass...IN type III toxin-antitoxin complex from E. coli.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7d8o', asym_id='I', title='Identification, functional characterization, ass...IN type III toxin-antitoxin complex from E. coli.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0004521', uniprot = '', pdbid = '7d8o', asym_id = 'I'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0004521', uniprot='', pdbid='7d8o', asym_id='I')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>