Structure of PDB 7cpj Chain I

Receptor sequence

>7cpjI (length=141) Species: 1182671 (Escherichia coli KTE64)

AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEK
GLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKI
SRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED

3D structure

• PDB: 7cpj The landscape of translational stall sites in bacteria revealed by monosome and disome profiling.
• Chain: I
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	V8 K9 L10 Q11 P25 Q29 P55 K71 P74 A76 S89 G90 K112 M116 A123 M124 S127 G130 T131 S134 M135	V8 K9 L10 Q11 P25 Q29 P55 K71 P74 A76 S89 G90 K112 M116 A123 M124 S127 G130 T131 S134 M135

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 08:42:19 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7cpj', asym_id = 'I', title = 'The landscape of translational stall sites in bacteria revealed by monosome and disome profiling.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7cpj', asym_id='I', title='The landscape of translational stall sites in bacteria revealed by monosome and disome profiling.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7cpj', asym_id = 'I'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7cpj', asym_id='I')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>