Structure of PDB 7b7u Chain I

Receptor sequence

>7b7uI (length=115) Species: 9825 (Sus scrofa domesticus) [Search protein sequence]

FVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRL
YYVCTAPHCGHRWTE

3D structure

PDB

7b7u Cryo-EM structure of mammalian RNA polymerase II in complex with human RPAP2.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C17 C39	C7 C29

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0001193	maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II
GO:0006283	transcription-coupled nucleotide-excision repair
GO:0006351	DNA-templated transcription
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005730	nucleolus

External links

PDB	RCSB:7b7u, PDBe:7b7u, PDBj:7b7u
PDBsum	7b7u
PubMed	34021257
UniProt	P60899\|RPB9_PIG DNA-directed RNA polymerase II subunit RPB9 (Gene Name=POLR2I)