Structure of PDB 7b04 Chain I

Receptor sequence

>7b04I (length=292) Species: 174633 (Candidatus Kuenenia stuttgartiensis)

AEGVKGVAEEELTPAKEVLNVKYMQIDVPAHITVGALEGAFKNAEGVQVK
LQKQDKAFPNGGGSVNSAEIKAIHDGITIYFQVIWDDATDNKQAIATQEF
RDGAALMFPLGKITISPEEPFSPRMGDRQKPVNLWHWKADWEADLLATGG
IEECPARYPNMHDDFSTNPHSVNYHKGVIQSAAELSGGYAAHNLLSLPRG
RAVEDLNAEGFGTLTSQDHQDVDGCSKFENKKWTVVFCRSLNTGDPLDVQ
FVPGESTYFNMAVWNGDREDRNGQKNISIQWHPLSLERIAWQ

3D structure

• PDB: 7b04 Structural and functional characterization of the intracellular filament-forming nitrite oxidoreductase multiprotein complex
• Chain: I
• Resolution: 2.97 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	I	Q84 A135 M137 R154 M155 H166 F241 G242 L244 N290 M291 A292 W294 N302 K305 I307	Q54 A105 M107 R124 M125 H136 F211 G212 L214 N260 M261 A262 W264 N272 K275 I277
BS02	CA	I	D117 T119 N121 D132 N295	D87 T89 N91 D102 N265
BS03	CA	I	D235 Q247 H249 D251 D275 D278	D205 Q217 H219 D221 D245 D248

Gene Ontology

Molecular Function

• GO:0020037 heme binding

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:7b04, PDBe:7b04, PDBj:7b04
• PDBsum: 7b04
• UniProt: Q1PZD4