Structure of PDB 7arc Chain I

Receptor sequence

>7arcI (length=199) Species: 37502 (Polytomella sp. Pringsheim 198.80)

GTERRPGQSGAWKQVDKQRYSSEWEQDPTFKQVPKNVSEVLDDSVSVLFL
TDIVRGMMYSASGFFDDKVTILYPFEKGAVSPRFRGEHALRRYPTGEERC
ISCKLCEAICPAQAITIEAEEREDGSRKTTRYDIDMTKCIYCGFCQEACP
VDAIVEGPNFEFSTETREELLYDKQKLLENGDKWEQEIAANLRTESLYR

3D structure

• PDB: 7arc A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
• Chain: I
• Resolution: 2.88 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	I	R161 E198 E199 L201 Y202 D203	R131 E168 E169 L171 Y172 D173
BS02	SF4	I	H118 C140 P141 I145 C169 I170 Y171 C172 G173 F174 C175 E186	H88 C110 P111 I115 C139 I140 Y141 C142 G143 F144 C145 E156
BS03	SF4	I	C130 I131 S132 C133 K134 C136 Y162 C179 A183 I184	C100 I101 S102 C103 K104 C106 Y132 C149 A153 I154

Gene Ontology

Molecular Function

• GO:0003954 NADH dehydrogenase activity
• GO:0016651 oxidoreductase activity, acting on NAD(P)H
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006120 mitochondrial electron transport, NADH to ubiquinone
• GO:0032981 mitochondrial respiratory chain complex I assembly

Cellular Component

• GO:0005739 mitochondrion
• GO:0016020 membrane

External links

• PDB: RCSB:7arc, PDBe:7arc, PDBj:7arc
• PDBsum: 7arc
• PubMed: 33768254
• UniProt: A0A7S0UQ60