Structure of PDB 7aqc Chain I

Receptor sequence
>7aqcI (length=133) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
VVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGLIIPVE
ISVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVKRDKVRE
IAETKMPDLNAADVEAAMRMVEGTARSMGIVIE
3D structure
PDB7aqc Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
ChainI
Resolution2.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I K10 L11 Q12 A75 S87 G88 E91 N93 L116 A118 A123 R126 M127 T131 S134 K3 L4 Q5 A68 S80 G81 E84 N86 L109 A111 A116 R119 M120 T124 S127
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
GO:0046677 response to antibiotic
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aqc, PDBe:7aqc, PDBj:7aqc
PDBsum7aqc
PubMed33259811
UniProtQ06796|RL11_BACSU Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]