Structure of PDB 7aoe Chain I

Receptor sequence

>7aoeI (length=57) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]

SLIFCSECGNLLESTTAQWTTCDQCQSVYPSEQFANLVVETKSSASAFPS
ALKLKHS

3D structure

PDB

7aoe Conserved strategies of RNA polymerase I hibernation and activation.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C10 C27	C5 C22

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006362	transcription elongation by RNA polymerase I
GO:0006363	termination of RNA polymerase I transcription

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005736	RNA polymerase I complex
GO:0005829	cytosol
GO:0055029	nuclear DNA-directed RNA polymerase complex

External links

PDB	RCSB:7aoe, PDBe:7aoe, PDBj:7aoe
PDBsum	7aoe
PubMed	33536435
UniProt	O94703\|RPA12_SCHPO DNA-directed RNA polymerase I subunit RPA12 (Gene Name=rpa12)