Structure of PDB 7aoc Chain I

Receptor sequence
>7aocI (length=57) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
SLIFCSECGNLLESTTAQWTTCDQCQSVYPSEQFANLVVETKSSASAFPS
ALKLKHS
3D structure
PDB7aoc Conserved strategies of RNA polymerase I hibernation and activation.
ChainI
Resolution3.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN I C10 C27 C5 C22
Gene Ontology
Molecular Function
GO:0001054 RNA polymerase I activity
GO:0003676 nucleic acid binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006362 transcription elongation by RNA polymerase I
GO:0006363 termination of RNA polymerase I transcription
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005736 RNA polymerase I complex
GO:0005829 cytosol
GO:0055029 nuclear DNA-directed RNA polymerase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7aoc, PDBe:7aoc, PDBj:7aoc
PDBsum7aoc
PubMed33536435
UniProtO94703|RPA12_SCHPO DNA-directed RNA polymerase I subunit RPA12 (Gene Name=rpa12)

[Back to BioLiP]