Structure of PDB 7a3q Chain I |
>7a3qI (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] |
EVQLVESGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGW INAGNGNTKYSQKFQDRVTITRDTSASTAYMELSSLRSEDTAIYYCARDK VDDYGDYWFPTLWYFDYWGQGTLVTV |
|
PDB | 7a3q The epitope arrangement on flavivirus particles contributes to Mab C10's extraordinary neutralization breadth across Zika and dengue viruses. |
Chain | I |
Resolution | 2.7 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3CX |
I |
G42 Q43 |
G42 Q43 |
|
|
|