Structure of PDB 6zxa Chain I

Receptor sequence
>6zxaI (length=69) Species: 765910 (Marichromatium purpuratum 984) [Search protein sequence]
KVPVMMADESIATINHPEDDWKIWTVINPATWMVPFFGILFVQMWLIHSY
ALSLPGYGFKDSVRVAQPA
3D structure
PDB6zxa The 2.4 angstrom cryo-EM structure of a heptameric light-harvesting 2 complex reveals two carotenoid energy transfer pathways.
ChainI
Resolution2.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 QSE I H17 K23 I24 H16 K22 I23
BS02 BCL I H17 P18 D21 H16 P17 D20
BS03 QS2 I P4 V5 M7 F37 P3 V4 M6 F36
BS04 QSE I F37 F38 L41 Q44 Y51 F36 F37 L40 Q43 Y50
BS05 BCL I F42 M45 H49 F41 M44 H48
BS06 BCL I Q44 I48 H49 Y58 Q43 I47 H48 Y57
BS07 QSE I M45 H49 L53 M44 H48 L52
External links