Structure of PDB 6yhs Chain I

Receptor sequence
>6yhsI (length=137) Species: 575584 (Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841) [Search protein sequence]
MLQPKRTKFRKVHKGRNTGLAHRGSTVSFGSIAIKATERGRMTARQIEAA
RRTISRRIKRGGKIFIRVFPDKPITEKPLEVRMGNGKGNVEYWVCEIKPG
KILYEIEGVNEDLAREAFALAAAKLPFKTTIVTRTVM
3D structure
PDB6yhs Structure of the 70S Ribosome from the Human Pathogen Acinetobacter baumannii in Complex with Clinically Relevant Antibiotics.
ChainI
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I K5 R6 K8 F9 R10 K11 V12 H13 K14 G15 R16 R23 R45 Q46 R56 R67 F69 E80 R82 M83 G84 N85 G86 K87 K124 K5 R6 K8 F9 R10 K11 V12 H13 K14 G15 R16 R23 R45 Q46 R56 R67 F69 E80 R82 M83 G84 N85 G86 K87 K124
BS02 rna I T18 G19 R39 T18 G19 R39
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6yhs, PDBe:6yhs, PDBj:6yhs
PDBsum6yhs
PubMed32857965
UniProtD0CD04

[Back to BioLiP]