Structure of PDB 6y39 Chain I

Receptor sequence

>6y39I (length=118) Species: 227321 (Aspergillus nidulans FGSC A4)

GTWANVNQGLQGTARDILTTYWQHVINHLESDNHDYKIHQLLLARIKKVM
KADPEVKMISAEAPILFAKGCDVFITELTMRAWIHAEDNKRRTLQRSDIA
AALSKSDMFDFLIDIVPR

3D structure

• PDB: 6y39 Structural basis of HapE P88L -linked antifungal triazole resistance in Aspergillus fumigatus .
• Chain: I
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	I	H85 T139	H39 T93

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 01:13:18 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6y39', asym_id = 'I', title = 'Structural basis of HapE P88L -linked antifungal triazole resistance in Aspergillus fumigatus .'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6y39', asym_id='I', title='Structural basis of HapE P88L -linked antifungal triazole resistance in Aspergillus fumigatus .')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003677,0046982', uniprot = '', pdbid = '6y39', asym_id = 'I'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0046982', uniprot='', pdbid='6y39', asym_id='I')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>