Structure of PDB 6xdq Chain I

Receptor sequence

>6xdqI (length=208) Species: 562 (Escherichia coli)

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEILG

3D structure

• PDB: 6xdq Structural basis of transcription-translation coupling.
• Chain: I
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	K80 M129 R132 R136	K79 M128 R131 R135
BS02	rna	I	G2 Q3 K4 V5 I14 R127 S154 G155 R156 E161 I162 A163 W167 R169 R172 V173 P174 H176 T177 L178 R179 E188 T192 Y193 G194 V195 K199	G1 Q2 K3 V4 I13 R126 S153 G154 R155 E160 I161 A162 W166 R168 R171 V172 P173 H175 T176 L177 R178 E187 T191 Y192 G193 V194 K198

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6xdq, PDBe:6xdq, PDBj:6xdq
• PDBsum: 6xdq
• PubMed: 32820061
• UniProt: P0A7V3|RS3_ECOLI Small ribosomal subunit protein uS3 (Gene Name=rpsC)