Structure of PDB 6wa0 Chain I

Receptor sequence

>6wa0I (length=31) Species: 32630 (synthetic construct)

EPETALLVAFVAYYTALIALIFAILATRRLM

3D structure

• PDB: 6wa0 De novo designed receptor transmembrane domains enhance CAR-T cytotoxicity and attenuate cytokine release
• Chain: I
• Resolution: 3.484 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	I	A12 T15 A16 A19 F22 A23 A26 R29 L30	A12 T15 A16 A19 F22 A23 A26 R29 L30

External links

• PDB: RCSB:6wa0, PDBe:6wa0, PDBj:6wa0
• PDBsum: 6wa0