Structure of PDB 6w6k Chain I

Receptor sequence

>6w6kI (length=127) Species: 83333 (Escherichia coli K-12)

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

• PDB: 6w6k Alternative conformations and motions adopted by 30S ribosomal subunits visualized by cryo-electron microscopy.
• Chain: I
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	T8 A15 K67 G68 G69 G70 S72 R105 D106 A107 R108 Q109 R112 K113 V115 G116 K119 R121 R123 F126 S127 R129	T6 A13 K65 G66 G67 G68 S70 R103 D104 A105 R106 Q107 R110 K111 V113 G114 K117 R119 R121 F124 S125 R127

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6w6k, PDBe:6w6k, PDBj:6w6k
• PDBsum: 6w6k
• PubMed: 32989043
• UniProt: P0A7X3|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)