Structure of PDB 6w1q Chain I

Receptor sequence
>6w1qI (length=36) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKD
3D structure
PDB6w1q Untangling the sequence of events during the S2→ S3transition in photosystem II and implications for the water oxidation mechanism.
ChainI
Resolution2.27 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA I V8 Y9 V11 V12 F15 V8 Y9 V11 V12 F15
BS02 CLA I V16 F23 V16 F23
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w1q, PDBe:6w1q, PDBj:6w1q
PDBsum6w1q
PubMed32434915
UniProtQ8DJZ6|PSBI_THEVB Photosystem II reaction center protein I (Gene Name=psbI)

[Back to BioLiP]