Structure of PDB 6vmi Chain I

Receptor sequence
>6vmiI (length=179) Species: 9606 (Homo sapiens) [Search protein sequence]
GSKAVTRHRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGL
IRLLRREIAAVFQDNRMIAVCQNVALSAEDKLLMRHQLRKHKILMKVFPN
QVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLG
GCIDDTILSRQGFINYSKLPSLPLVQGEL
3D structure
PDB6vmi Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
ChainI
Resolution2.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I S30 K31 V33 T34 R35 R38 H41 F42 Q43 A106 K124 V125 P127 N128 H150 S2 K3 V5 T6 R7 R10 H13 F14 Q15 A78 K96 V97 P99 N100 H122
BS02 peptide I D182 Q204 E206 D154 Q176 E178
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vmi, PDBe:6vmi, PDBj:6vmi
PDBsum6vmi
PubMed32737313
UniProtQ7Z7H8|RM10_HUMAN Large ribosomal subunit protein uL10m (Gene Name=MRPL10)

[Back to BioLiP]