Structure of PDB 6tnp Chain I |
>6tnpI (length=109) Species: 10090 (Mus musculus) [Search protein sequence] |
QVQLQQSDAELVKPGSSVKISCKASGYTFTDHAIHWVKQKPEQGLEWIGH FIKYNDKFKGKATLTVDRSSSTAYMQLNSLTSEDSAVYFCKTSTFFFDYW GQGTTLTVS |
|
PDB | 6tnp Structural characterization of an unprecedented lectin-like antitumoral anti-MUC1 antibody. |
Chain | I |
Resolution | 3.0 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NO8 |
I |
H32 S99 F102 |
H32 S93 F96 |
|
|
|