Structure of PDB 6tjv Chain I

Receptor sequence
>6tjvI (length=193) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
KFLNQITNYAKEAVQSAKYIGQGLSVTFDHMRRRPITVQYPYEKLIPSER
FRGRIHFEFDKCIACEVCVRVCPINLPVVDWVFNKELKKKELKHYSIDFG
VCIFCANCVEYCPTNCLSVTEEYELATYDRHELNYDSVAMGRIPYKVTQD
PMVTPIREFAYLPAGVMSGHDLPAGAQRAGERPEAIANTAKSS
3D structure
PDB6tjv Redox-coupled proton pumping drives carbon concentration in the photosynthetic complex I.
ChainI
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 I C73 P74 C103 I104 F105 C106 A107 N108 C109 C72 P73 C102 I103 F104 C105 A106 N107 C108
BS02 SF4 I C63 I64 A65 C66 E67 V68 C69 Y96 C113 P114 C117 C62 I63 A64 C65 E66 V67 C68 Y95 C112 P113 C116
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0016651 oxidoreductase activity, acting on NAD(P)H
GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
GO:0046872 metal ion binding
GO:0048038 quinone binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0019684 photosynthesis, light reaction
GO:1902600 proton transmembrane transport
Cellular Component
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tjv, PDBe:6tjv, PDBj:6tjv
PDBsum6tjv
PubMed31980611
UniProtQ8DL31|NDHI_THEVB NAD(P)H-quinone oxidoreductase subunit I (Gene Name=ndhI)

[Back to BioLiP]