Structure of PDB 6su0 Chain I

Receptor sequence
>6su0I (length=89) Species: 305 (Ralstonia solanacearum) [Search protein sequence]
SVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVT
SWLVGSAIHIRVYASTGTTTTEWCWDGKGWYKGAYTSTN
3D structure
PDB6su0 Engineered assembly of a protein-cucurbituril biohybrid.
ChainI
Resolution1.98 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 QQ7 I X79 G80 Y82 X78 G79 Y81
BS02 MFU I R62 E73 G84 A85 R61 E72 G83 A84
BS03 MFU I W31 W36 W30 W35
BS04 QQ7 I D32 X34 G35 Y37 D31 X33 G34 Y36
BS05 MFU I R17 E28 G39 A40 W76 W81 R16 E27 G38 A39 W75 W80
External links