Structure of PDB 6rqf Chain I

Receptor sequence

>6rqfI (length=215) Species: 3562 (Spinacia oleracea)

MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVAT
GFAMTFYYRPTVTDAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILH
VFRVYLTGGFKKPRELTWVTGVVLGVLTASFGVTGYSLPWDQIGYWAVKI
VTGVPDAIPVIGSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFML
MHFLMIRKQGISGPL

3D structure

• PDB: 6rqf Cryo-EM structure of the spinach cytochrome b6f complex at 3.6 angstrom resolution.
• Chain: I
• Resolution: 3.58 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R207 I211
• Catalytic site (residue number reindexed from 1): R207 I211

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	I	V30 I32	V30 I32
BS02	HEM	I	F44 Q47 G51 M54 R83 H86 F131 G135 L138 P139 H187 P192	F44 Q47 G51 M54 R83 H86 F131 G135 L138 P139 H187 P192
BS03	HEM	I	Y34 T40 M97 H100 V101 R103 V104 T117 W118 G121 H202 I206 S212	Y34 T40 M97 H100 V101 R103 V104 T117 W118 G121 H202 I206 S212

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane

External links

• PDB: RCSB:6rqf, PDBe:6rqf, PDBj:6rqf
• PDBsum: 6rqf
• PubMed: 31723268
• UniProt: P00165|CYB6_SPIOL Cytochrome b6 (Gene Name=petB)