Structure of PDB 6om0 Chain I

Receptor sequence

>6om0I (length=234) Species: 9606 (Homo sapiens) [Search protein sequence]

NPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPP
AINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDV
PTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMG
VPYCIIKGKARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYND
RYDEIRRHWGGNVLGPKSVARIAKLEKAKAKELA

3D structure

PDB

6om0 Structural basis for selective stalling of human ribosome nascent chain complexes by a drug-like molecule.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	T52 Y60 I61 Q64 R65 R89 D160 K185 R189	T24 Y32 I33 Q36 R37 R61 D132 K157 R161
BS02	rna	I	K34 R35 K37 N38 F39 I41 G42 Q43 I45 Q46 P47 K48 R49 L51 R53 F54 K56 P58 R59 Y60 R73 L74 K110 R113 G139 V140 N141 T142 T145 D162 P163 L166 K187 A188 R192 R196 K197 C199 T200 P244 K245	K6 R7 K9 N10 F11 I13 G14 Q15 I17 Q18 P19 K20 R21 L23 R25 F26 K28 P30 R31 Y32 R45 L46 K82 R85 G111 V112 N113 T114 T117 D134 P135 L138 K159 A160 R164 R168 K169 C171 T172 P216 K217

Gene Ontology

	Biological Process
GO:0042254	ribosome biogenesis

	Cellular Component
GO:1990904	ribonucleoprotein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6om0, PDBe:6om0, PDBj:6om0
PDBsum	6om0
PubMed	31160784
UniProt	P62424\|RL7A_HUMAN Large ribosomal subunit protein eL8 (Gene Name=RPL7A)

[Back to BioLiP]