Structure of PDB 6n8n Chain I

Receptor sequence

>6n8nI (length=220) Species: 559292 (Saccharomyces cerevisiae S288C)

QVAAERAARKAANKEKRAIILERNAAYQKEYETAERNIIQAKRDAKAAGS
YYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVTKATL
ELLKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEANLG
KYGILSIDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKHFI
QGGSFGNREEFINKLVKSMN

3D structure

• PDB: 6n8n Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
• Chain: I
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	R30 R33 K34 N37 R41 R60 R67 K70 K90 G91 I92 N93 K94 P97 K98 L105 R110 I111 K121 E125 L126 S142 R145 K150 K158 Q159 R160 D165 K196 N200 K206 L207 N209 P210 S211 W214 R218 K219 K241	R6 R9 K10 N13 R17 R36 R43 K46 K66 G67 I68 N69 K70 P73 K74 L81 R86 I87 K97 E101 L102 S118 R121 K126 K134 Q135 R136 D141 K172 N176 K182 L183 N185 P186 S187 W190 R194 K195 K217
BS02	rna	I	K128 R218 H222 I224 Q225	K104 R194 H198 I200 Q201

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000470 maturation of LSU-rRNA
• GO:0002181 cytoplasmic translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6n8n, PDBe:6n8n, PDBj:6n8n
• PDBsum: 6n8n
• PubMed: 30814529
• UniProt: P05737|RL7A_YEAST Large ribosomal subunit protein uL30A (Gene Name=RPL7A)