Structure of PDB 6j6g Chain I

Receptor sequence
>6j6gI (length=102) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
RGGISYDQLAKLSYEKTLRNLATQTQNSSKQDKVQKDTKTGKITIADDDK
LVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFINDKNKQFNEKLSR
ES
3D structure
PDB6j6g Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
ChainI
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I Y97 L100 L103 S104 K107 K121 S172 R175 Y176 R179 K180 Y6 L9 L12 S13 K16 K30 S63 R66 Y67 R70 K71
BS02 rna I R179 K199 Q202 F203 K206 R209 R70 K90 Q93 F94 K97 R100
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0000386 second spliceosomal transesterification activity
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0071004 U2-type prespliceosome
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071008 U2-type post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6j6g, PDBe:6j6g, PDBj:6j6g
PDBsum6j6g
PubMed30879786
UniProtP53277|SYF2_YEAST Pre-mRNA-splicing factor SYF2 (Gene Name=SYF2)

[Back to BioLiP]