Structure of PDB 6hko Chain I

Receptor sequence

>6hkoI (length=66) Species: 559292 (Saccharomyces cerevisiae S288C)

SVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTT
ADDAFPSSLRAKKSVV

3D structure

• PDB: 6hko The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
• Chain: I
• Resolution: 3.42 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C10 C30 C33	C9 C29 C32

Gene Ontology

Molecular Function

• GO:0001054 RNA polymerase I activity
• GO:0003676 nucleic acid binding
• GO:0003899 DNA-directed 5'-3' RNA polymerase activity
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding
• GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding

Biological Process

• GO:0000122 negative regulation of transcription by RNA polymerase II
• GO:0006351 DNA-templated transcription
• GO:0006360 transcription by RNA polymerase I
• GO:0006361 transcription initiation at RNA polymerase I promoter
• GO:0006362 transcription elongation by RNA polymerase I
• GO:0006363 termination of RNA polymerase I transcription
• GO:0042254 ribosome biogenesis
• GO:0042790 nucleolar large rRNA transcription by RNA polymerase I

Cellular Component

• GO:0000428 DNA-directed RNA polymerase complex
• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005736 RNA polymerase I complex
• GO:0055029 nuclear DNA-directed RNA polymerase complex

External links

• PDB: RCSB:6hko, PDBe:6hko, PDBj:6hko
• PDBsum: 6hko
• PubMed: 30913026
• UniProt: P32529|RPA12_YEAST DNA-directed RNA polymerase I subunit RPA12 (Gene Name=RPA12)