Structure of PDB 6h67 Chain I

Receptor sequence

>6h67I (length=63) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

SVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTT
ADDAFPSSLRAKK

3D structure

PDB

6h67 Structural basis of RNA polymerase I stalling at UV light-induced DNA damage.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C10 C30	C9 C29

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding
GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0006351	DNA-templated transcription
GO:0006360	transcription by RNA polymerase I
GO:0006361	transcription initiation at RNA polymerase I promoter
GO:0006362	transcription elongation by RNA polymerase I
GO:0006363	termination of RNA polymerase I transcription
GO:0042254	ribosome biogenesis
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005736	RNA polymerase I complex
GO:0055029	nuclear DNA-directed RNA polymerase complex

External links

PDB	RCSB:6h67, PDBe:6h67, PDBj:6h67
PDBsum	6h67
PubMed	30127008
UniProt	P32529\|RPA12_YEAST DNA-directed RNA polymerase I subunit RPA12 (Gene Name=RPA12)