Structure of PDB 6fyy Chain I

Receptor sequence

>6fyyI (length=188) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]

GISRDSRHKRAATGAKRAQFRKKRKFELGRQAANTKIGTKRIHPVRTRGG
NQKFRALRIETGNFSWASEGVARKTRITGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWYESHYGQSLGKTSKNTERKWAARAAEAKIEHAVDSQFGA
GRLYAAISSRPGQSGRCDGYILEGEELAFYLRRLTAKK

3D structure

PDB

6fyy Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.

Chain

Resolution

3.02 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	G2 I3 R5 D6 S7 R8 H9 K10 R11 A12 A13 T14 G15 A16 A19 F21 R22 K23 K24 R25 K26 F27 L29 G30 R31 Q32 A33 A34 K41 R42 I43 H44 R47 T48 R49 G50 G51 N52 K54 R56 L58 R59 N64 S66 A73 R74 K75 S86 N87 T97 K98 A99 S137 K138 N139 R142 K143 S171 S172 R173 G175 Q176 R179 D181	G1 I2 R4 D5 S6 R7 H8 K9 R10 A11 A12 T13 G14 A15 A18 F20 R21 K22 K23 R24 K25 F26 L28 G29 R30 Q31 A32 A33 K40 R41 I42 H43 R46 T47 R48 G49 G50 N51 K53 R55 L57 R58 N63 S65 A72 R73 K74 S85 N86 T96 K97 A98 S124 K125 N126 R129 K130 S158 S159 R160 G162 Q163 R166 D168

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6fyy, PDBe:6fyy, PDBj:6fyy
PDBsum	6fyy
PubMed	30475211
UniProt	Q6CMG3

[Back to BioLiP]