Structure of PDB 6ft6 Chain I

Receptor sequence
>6ft6I (length=131) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MGRYSVKRYKTKRRTRDLDLIYNDLSTKESVQKLLNQPLDETKPGLGQHY
CIHCAKYMETAIALKTHLKGKVHKRRVKELRGVPYTQEVSDAAAGYNLNK
FLNRVQEITQSVGPEKESNEALLKEHLDSTL
3D structure
PDB6ft6 Structure of the nuclear exosome captured on a maturing preribosome.
ChainI
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I M1 G2 R3 S5 R8 K10 T11 K12 R13 K56 I62 T66 K71 R75 M1 G2 R3 S5 R8 K10 T11 K12 R13 K56 I62 T66 K71 R75
BS02 ZN I C51 C54 H67 H73 C51 C54 H67 H73
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding
GO:0043023 ribosomal large subunit binding
GO:0046872 metal ion binding
Biological Process
GO:0000055 ribosomal large subunit export from nucleus
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ft6, PDBe:6ft6, PDBj:6ft6
PDBsum6ft6
PubMed29519915
UniProtQ08004|BUD20_YEAST Bud site selection protein 20 (Gene Name=BUD20)

[Back to BioLiP]