Structure of PDB 6e4p Chain I |
>6e4pI (length=71) Species: 5691 (Trypanosoma brucei) [Search protein sequence] |
GSHMRVQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPED AARAITELQASELEGATLFLR |
|
PDB | 6e4p The RRM of the kRNA-editing protein TbRGG2 uses multiple surfaces to bind and remodel RNA. |
Chain | I |
Resolution | 1.949 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
I |
W215 H216 C231 |
W17 H18 C33 |
|
|
|
|