Structure of PDB 6d9j Chain I

Receptor sequence

>6d9jI (length=205) Species: 9986 (Oryctolagus cuniculus)

GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGH
MVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINK
MLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVVEALRRAKFKF
PGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPNRGPLDKW
RALHS

3D structure

• PDB: 6d9j Dual tRNA mimicry in the Cricket Paralysis Virus IRES uncovers an unexpected similarity with the Hepatitis C Virus IRES.
• Chain: I
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	R3 R4 R7 C8 Y9 K13 N14 K15 F22 D35 K39 E63 A64 K74 K78 R90 H92 F94 Q112 G114 M115 R116 A118 F119 G120 R154 F157 P160 R162 D193 G194 C195 K198	R2 R3 R6 C7 Y8 K12 N13 K14 F21 D34 K38 E62 A63 K73 K77 R89 H91 F93 Q103 G105 M106 R107 A109 F110 G111 R145 F148 P151 R153 D184 G185 C186 K189
BS02	rna	I	Y11 E56 N202 R203 G204 P205 L206 W209	Y10 E55 N193 R194 G195 P196 L197 W200
BS03	rna	I	R24 K101	R23 K100

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation
• GO:0006417 regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6d9j, PDBe:6d9j, PDBj:6d9j
• PDBsum: 6d9j
• PubMed: 29856316
• UniProt: B7NZQ2|RL10_RABIT Large ribosomal subunit protein uL16 (Gene Name=RPL10)