Structure of PDB 5zji Chain I

Receptor sequence
>5zjiI (length=33) Species: 4577 (Zea mays) [Search protein sequence]
TDFNLPSIFVPLVGLVFPAIAMTSLFLYVQKNK
3D structure
PDB5zji Structure of the maize photosystem I supercomplex with light-harvesting complexes I and II.
ChainI
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA I L6 P7 F10 V14 L5 P6 F9 V13
BS02 CLA I G15 L16 G14 L15
BS03 CLA I F27 Q31 F26 Q30
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zji, PDBe:5zji, PDBj:5zji
PDBsum5zji
PubMed29880686
UniProtP30980|PSAI_MAIZE Photosystem I reaction center subunit VIII (Gene Name=psaI)

[Back to BioLiP]