Structure of PDB 5z3g Chain I

Receptor sequence
>5z3gI (length=150) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
KWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGKRVVYLKH
LEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKFNVEYFA
KEEIKAERVEDQKVVDKALIAEIKKTPLLKQYLSASFSLKNGDKPHMLKF
3D structure
PDB5z3g Cryo-EM structure of an early precursor of large ribosomal subunit reveals a half-assembled intermediate.
ChainI
Resolution3.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna I K8 W9 A17 K19 K20 T21 R22 K23 A24 R26 A44 R46 R48 T62 F69 K70 V71 G73 P75 R77 R78 N80 R82 Y83 K108 E129 Q157 A161 S162 N167 K1 W2 A10 K12 K13 T14 R15 K16 A17 R19 A37 R39 R41 T55 F62 K63 V64 G66 P68 R70 R71 N73 R75 Y76 K101 E103 Q131 A135 S136 N141
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5z3g, PDBe:5z3g, PDBj:5z3g
PDBsum5z3g
PubMed29557065
UniProtQ02326|RL6A_YEAST Large ribosomal subunit protein eL6A (Gene Name=RPL6A)

[Back to BioLiP]