Structure of PDB 5y5s Chain I

Receptor sequence
>5y5sI (length=57) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]
TMNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNIP
VSYQALG
3D structure
PDB5y5s Structure of photosynthetic LH1-RC supercomplex at 1.9 angstrom resolution.
ChainI
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CRT I L33 H36 L31 H34
BS02 CA I W46 D49 I51 W44 D47 I49
BS03 BCL I Q28 H36 W46 Q26 H34 W44
BS04 BCL I Q28 L31 G32 I35 H36 Q26 L29 G30 I33 H34
BS05 CRT I L21 I24 F27 L19 I22 F25
BS06 CRT I I11 I14 I9 I12
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5y5s, PDBe:5y5s, PDBj:5y5s
PDBsum5y5s
PubMed29618814
UniProtD2Z0P2

[Back to BioLiP]