Structure of PDB 5xtb Chain I

Receptor sequence
>5xtbI (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
ATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNY
YCTRDGRRESVPPSIIMSSQKTEKKAVTPAPPIKRWELSSDQPYL
3D structure
PDB5xtb Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
ChainI
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide I W14 H18 P39 K40 L41 P42 W11 H15 P36 K37 L38 P39
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008137 NADH dehydrogenase (ubiquinone) activity
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0009060 aerobic respiration
GO:0042773 ATP synthesis coupled electron transport
GO:0042776 proton motive force-driven mitochondrial ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5xtb, PDBe:5xtb, PDBj:5xtb
PDBsum5xtb
PubMed28844695
UniProtO95182|NDUA7_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 (Gene Name=NDUFA7)

[Back to BioLiP]