Structure of PDB 5x50 Chain I |
>5x50I (length=113) Species: 981350 (Komagataella phaffii CBS 7435) [Search protein sequence] |
ASFRFCLECNNMLYPKEDKENQRLLYSCRNCDYTELAEDPKVYRHELITN IGETAGIVDDIGQDPTLPRSDKECPECHSRDCVFFQSQQRRKDTNMTLFY VCLNCKKTFRDES |
|
PDB | 5x50 Crystal structure of RNA polymerase II from Komagataella pastoris |
Chain | I |
Resolution | 4.293 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
I |
C75 N105 C106 |
C74 N104 C105 |
|
|
|
|