Structure of PDB 5wf0 Chain I

Receptor sequence

>5wf0I (length=141) Species: 562 (Escherichia coli) [Search protein sequence]

AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEK
GLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKI
SRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED

3D structure

PDB

5wf0 Cryo-EM shows stages of initial codon selection on the ribosome by aa-tRNA in ternary complex with GTP and the GTPase-deficient EF-TuH84A.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	P53 I54 K71 T72 P73 P74 A75 A76 V77 K80 K86 S87 G88 S89 G90 K91 P92 N93 K94 D115 M116 T117 A119 A123 R126 S127 I128 G130 T131 R133 S134 M135	P53 I54 K71 T72 P73 P74 A75 A76 V77 K80 K86 S87 G88 S89 G90 K91 P92 N93 K94 D115 M116 T117 A119 A123 R126 S127 I128 G130 T131 R133 S134 M135
BS02	rna	I	S20 P21 P25	S20 P21 P25

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination
GO:0015968	stringent response

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5wf0, PDBe:5wf0, PDBj:5wf0
PDBsum	5wf0
PubMed	29733411
UniProt	P0A7J7\|RL11_ECOLI Large ribosomal subunit protein uL11 (Gene Name=rplK)