Structure of PDB 5no4 Chain I

Receptor sequence

>5no4I (length=127) Species: 83333 (Escherichia coli K-12)

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

• PDB: 5no4 RsgA couples the maturation state of the 30S ribosomal decoding center to activation of its GTPase pocket.
• Chain: I
• Resolution: 5.16 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	Y7 R11 K13 S14 R18 F20 Y38 R41 Y64 K68 G69 G70 G71 S73 G74 Q75 R85 R99 T105 R106 R109 Q110 V111 E112 R113 K114 K115 L118 R119 K120 R122 R123 Q126 F127 R130	Y4 R8 K10 S11 R15 F17 Y35 R38 Y61 K65 G66 G67 G68 S70 G71 Q72 R82 R96 T102 R103 R106 Q107 V108 E109 R110 K111 K112 L115 R116 K117 R119 R120 Q123 F124 R127

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5no4, PDBe:5no4, PDBj:5no4
• PDBsum: 5no4
• PubMed: 28482099
• UniProt: P0A7X3|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)