Structure of PDB 5n5e Chain I |
>5n5eI (length=98) Species: 1185654 (Pyrococcus furiosus COM1) [Search protein sequence] |
GLSINPTLINRDKPYTKEELMEILRLAIIAELDAINLYEQMARYSEDENV RKILLDVAREEKAHVGEFMALLLNLDPEQVTELKGGFEEVKELTGIEA |
|
PDB | 5n5e Conservation of the structural and functional architecture of encapsulated ferritins in bacteria and archaea. |
Chain | I |
Resolution | 2.026 Å |
3D structure |
|
|
Enzyme Commision number |
1.16.3.1: ferroxidase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
I |
E32 E62 H65 |
E31 E61 H64 |
|
|
|
|