Structure of PDB 5my1 Chain I

Receptor sequence

>5my1I (length=127) Species: 83333 (Escherichia coli K-12)

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

• PDB: 5my1 Architecture of a transcribing-translating expressome.
• Chain: I
• Resolution: 7.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	Y6 T8 R10 K12 S13 R17 F19 K67 G68 G69 G70 I71 S72 Q74 R84 R98 V103 T104 R105 R108 Q109 E111 R112 K113 K114 V115 K119 R121 R122 R123 Q125 F126 S127 R129	Y4 T6 R8 K10 S11 R15 F17 K65 G66 G67 G68 I69 S70 Q72 R82 R96 V101 T102 R103 R106 Q107 E109 R110 K111 K112 V113 K117 R119 R120 R121 Q123 F124 S125 R127

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5my1, PDBe:5my1, PDBj:5my1
• PDBsum: 5my1
• PubMed: 28408604
• UniProt: P0A7X3|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)