Structure of PDB 5mki Chain I |
>5mkiI (length=70) Species: 406327 (Methanococcus vannielii SB) [Search protein sequence] |
DTQRPLDALGKSINTNVTVYLKDGKLVKGRLKAYDLHMNVALENAKIESD EEKEFPMLVVRGDNVLYVSL |
|
PDB | 5mki Crystal structures and RNA-binding properties of Lsm proteins from archaea Sulfolobus acidocaldarius and Methanococcus vannielii: Similarity and difference of the U-binding mode. |
Chain | I |
Resolution | 2.048 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
I |
H39 N41 R63 |
H37 N39 R61 |
|
|
|
|