Structure of PDB 5mdy Chain I

Receptor sequence
>5mdyI (length=135) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
QAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPI
PVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQ
LQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVV
3D structure
PDB5mdy Translational termination without a stop codon.
ChainI
Resolution3.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I K9 K71 A75 A76 G88 N93 M116 A123 R126 S127 T131 S134 K5 K67 A71 A72 G84 N89 M112 A119 R122 S123 T127 S130
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006415 translational termination
GO:0015968 stringent response
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mdy, PDBe:5mdy, PDBj:5mdy
PDBsum5mdy
PubMed27934701
UniProtP0A7J7|RL11_ECOLI Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]