Structure of PDB 5lzx Chain I

Receptor sequence

>5lzxI (length=205) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGH
MVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINK
MLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVVEALRRAKFKF
PGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPNRGPLDKW
RALHS

3D structure

PDB

5lzx Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.

Chain

Resolution

3.67 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	R3 R4 P5 A6 R7 C8 K13 N14 K15 P16 Y17 F22 R24 K30 D35 K39 K40 S61 E63 A64 A67 R88 R90 H92 F94 R98 N100 M115 R116 G117 A118 F119 G120 Q133 F157 K158 P160 D193 C195 K198	R2 R3 P4 A5 R6 C7 K12 N13 K14 P15 Y16 F21 R23 K29 D34 K38 K39 S60 E62 A63 A66 R87 R89 H91 F93 R97 N99 M106 R107 G108 A109 F110 G111 Q124 F148 K149 P151 D184 C186 K189
BS02	rna	I	Y11 Y57 I131 N202 R203 G204 L206 W209	Y10 Y56 I122 N193 R194 G195 L197 W200

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation
GO:0006417	regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lzx, PDBe:5lzx, PDBj:5lzx
PDBsum	5lzx
PubMed	27863242
UniProt	B7NZQ2\|RL10_RABIT Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]