Structure of PDB 5jup Chain I

Receptor sequence

>5jupI (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ

3D structure

PDB

5jup Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	K8 A11 Y12 R15 F16 Q17 R23 G26 T28 D29 Y31 Q32 R35 L36 K43 Y44 T46 L113 P139 R140 P141 F142 F145 L146 I148 L150 R152 T153 F160 P174 H175 S176 N178 R179	K7 A10 Y11 R14 F15 Q16 R22 G25 T27 D28 Y30 Q31 R34 L35 K42 Y43 T45 L112 P138 R139 P140 F141 F144 L145 I147 L149 R151 T152 F159 P173 H174 S175 N177 R178
BS02	rna	I	A2 K8 S13 S14 F16 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 T56 N57 K58 D59 Q63 I65 I69 T70 G71 D72 V74 Y79 H90 N94 W95 R152 T154 T155 G156 A157 R158 P181 Y198 H203 V204 Q206 Y207 R218 L222 K224 Y226 T256 F260 Y265 A266 E268 S269 K270 Y272 Q274 T275 K276 L277 K279 R282	A1 K7 S12 S13 F15 T17 F19 R20 R21 R23 K26 T27 Y29 R32 R49 R53 T55 N56 K57 D58 Q62 I64 I68 T69 G70 D71 V73 Y78 H89 N93 W94 R151 T153 T154 G155 A156 R157 P180 Y197 H202 V203 Q205 Y206 R217 L221 K223 Y225 T255 F259 Y264 A265 E267 S268 K269 Y271 Q273 T274 K275 L276 K278 R281

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5jup, PDBe:5jup, PDBj:5jup
PDBsum	5jup
PubMed	27159452
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]