Structure of PDB 5j0n Chain I

Receptor sequence
>5j0nI (length=96) Species: 562 (Escherichia coli) [Search protein sequence]
ALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGN
FDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPK
3D structure
PDB5j0n Structure of a Holliday junction complex reveals mechanisms governing a highly regulated DNA transaction.
ChainI
Resolution11.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna I T4 K5 K57 R60 R63 N64 P65 T3 K4 K56 R59 R62 N63 P64
BS02 dna I S47 P61 R63 P65 K66 R82 S46 P60 R62 P64 K65 R81
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009295 nucleoid
GO:0032993 protein-DNA complex
GO:1990177 IHF-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j0n, PDBe:5j0n, PDBj:5j0n
PDBsum5j0n
PubMed27223329
UniProtP0A6X7|IHFA_ECOLI Integration host factor subunit alpha (Gene Name=ihfA)

[Back to BioLiP]